Skip to main content

Therapeutic monoclonal antibody targeting of neuronal pentraxin receptor to control metastasis in gastric cancer

Abstract

Background

Controlling metastasis is essential for improving the prognosis of patients with gastric cancer (GC). Here, we aimed to identify a molecule required for GC metastasis and to investigate its potential utility as a target for the development of therapeutic antibodies (Abs).

Methods

Transcriptome and bioinformatics analyses of human GC cell lines identified the neuronal pentraxin receptor (NPTXR) as a candidate molecule. NPTXR function was probed by modulating its expression in GC cells and assessing the effects on intracellular signaling and malignant behaviors in vitro and in mouse xenograft models. We also generated anti-NPTXR Abs and Nptxr−/− mice, and assessed the clinical significance of NPTXR expression in GC specimens.

Results

NPTXR mRNA expression in clinical specimens was associated with disease progression and was significantly higher in tissues from GC patients with distant metastasis compared with those without. NPTXR regulated expression of genes involved in metastatic behaviors as well as activation of the PI3K–AKT–mTOR, FAK–JNK, and YAP signaling pathways. NPTXR silencing promoted caspase-mediated apoptosis and attenuated GC cell proliferation, cell cycle progression, migration, invasion, adhesion, stem cell-like properties, and resistance to 5-fluorouracil in vitro, and also inhibited the tumorigenicity of GC cells in vivo. Anti-NPTXR Abs inhibited GC peritoneal metastasis in mice. Nptxr−/− mice showed no abnormalities in reproduction, development, metabolism, or motor function.

Conclusions

NPTXR plays an essential role in controlling the malignant behavior of GC cells in vitro and in vivo. NPTXR-targeting Abs may thus have utility as novel diagnostic tools and/or treatment modalities for GC.

Introduction

Although the incidence of gastric cancer (GC) has decreased over the past few decades, it is still one of the three most common malignancies worldwide and remains a global health burden [1]. GC can be treated when diagnosed sufficiently early, and patients undergoing resection can expect an excellent prognosis. However, patients diagnosed with advanced cancer face a dire prognosis, mainly because of the propensity for GC to metastasize [2].

The only therapeutic options currently available for patients with unresectable or metastatic GC are combinations of cytotoxic anti-cancer agents and targeted therapies such as monoclonal antibodies (mAbs) [3]. Trastuzumab (anti-Her2), ramucirumab (anti-vascular endothelial growth factor receptor 2), nivolumab (anti-PD-1), and pembrolizumab (anti-PD-L1) are mAbs that target growth factor receptors or immune checkpoints and have demonstrated efficacy for GC in large-scale clinical trials [4,5,6]. However, the efficacy and prognosis of these treatments are unpredictable owing to the clinical heterogeneity and molecular complexity of GC [7, 8]. Moreover, some mAbs are not well tolerated, leaving the patient with few treatment options [9]. There is thus an urgent need to identify candidate therapeutic targets for the development of agents that can control cancer metastasis through novel mechanisms.

To this end, we performed transcriptome and bioinformatics analysis of GC tissues from patients with or without metastasis to identify novel candidate targets involved in metastasis. We identified neuronal pentraxin receptor (NPTXR) as being specifically overexpressed in GC tissues with metastatic potential. NPTXR is a type II transmembrane protein that functions as a trans-synaptic organizer and anchors neuronal pentraxin complexes to plasma membranes [10, 11]. However, little is known about its possible roles in cancer [12]. We investigated the expression and function of NPTXR by in vitro and in vivo analysis of human GC cell lines, tumor xenograft mouse models, and Nptxr-deficient (Nptxr−/−) mice. We also developed polyclonal Abs (pAbs) and mAbs against NPTXR and evaluated their potential utility as diagnostic tools and/or therapeutic agents for GC.

Materials and methods

More details were provided in Additional file 1.

Cell lines and clinical samples

The GC cell lines GCIY, IM95, MKN1, MKN7, MKN45, MKN74, NUGC2, NUGC3, NUGC4, OCUM-1, and SC-6-JCK were obtained from the Japanese Collection of Research Bioresources Cell Bank (JCRB, Osaka, Japan). AGS, KATOIII, and N87 GC cell lines and a nontumorigenic epithelial cell line (FHs74) were acquired from the American Type Culture Collection (Manassas, VA, USA). Three hundred pairs of surgically resected GC and adjacent noncancerous tissues were obtained from patients who underwent gastrectomy. A freely available integrated dataset (n = 1065 GC patients) was accessed at http://kmplot.com/analysis/ [13].

Transcriptome analysis

The HiSeq System (Illumina, San Diego, CA, USA) was used to perform global expression profiling of 57,749 genes, including splice variants, in clinical specimens (n = 4 each) from patients with no metastasis for > 5 years, or patients with peritoneal recurrence, liver recurrence, or distant node metastasis within 2 years after surgery.

Quantitative reverse-transcription PCR (qRT-PCR) analysis of NPTXR and 84 cancer-related genes

Total RNA was extracted from clinical specimens or cell lines using an RNeasy Mini Kit (Qiagen, Hilden, Germany). Specific primers are listed in Additional file 2 (Table S1). Genes expressed in association with NPTXR in GC cell lines were analyzed using the Human Epithelial to Mesenchymal Transition RT2 Profiler PCR Array (Qiagen) [14].

NPTXR knockdown (KD), knockout (KO), and overexpression in GC cell lines

To modulate NPTXR expression, we generated GC cell lines with small interfering RNA (siRNA)-mediated KD, short hairpin RNA (shRNA)-mediated KD, CRISPR-Cas9-mediated stable KO, and forced overexpression (see Additional file 2: Table S1 1 for sequence details). Genome editing using the CRISPR-Cas9 system was used to generate stable NPTXR-KO GC cell lines from MKN1 cells stably expressing luciferase because it expressed one of the highest levels of NPTXR mRNA, had high abilities in cell migration and invasion in our previous studies and is engrafted in nude mice for subcutaneous and peritoneal xenograft models [15, 16].

Proliferation, apoptosis, and cell cycle assays

Cell proliferation was analyzed using the Cell Counting Kit-8 (CCK-8) assay (Dojindo Molecular Technologies, Inc., Kumamoto, Japan). Apoptosis was measured using an annexin V-Alexa Fluor 568 conjugate (A13202, Thermo Fisher Scientific). Total caspase activity was measured using a Muse Multi-caspase kit (MCH100109, Merck Millipore, Billerica, MA, USA). A Caspase Colorimetric Assay Kit (BioVision, Milpitas, CA, USA) was used to measure the activity of caspase-3, 8, 9, and − 12 individually. The Muse MitoPotential kit (Merck Millipore) was used to assess the mitochondrial membrane potential. Cell cycle progression was analyzed using a Muse Cell Cycle Kit (Merck Millipore). We also analyzed the cell cycle using a Cell Cycle Assay Cell-Clock Kit (Biocolor, Carrickfergus, UK).

Cell migration, invasion, adhesion and aldehyde dehydrogenase (ALDH) assays

Cell migration was assessed using wound-healing assays. Cell invasion was measured using BioCoat Matrigel invasion chambers (BD Biosciences, Bedford, MA, USA). The CytoSelect 48-Well Cell Adhesion Assay (Cell Biolabs, San Diego, CA, USA) was used to determine cell adhesion to the extracellular matrix proteins. ALDH was measured using the ALDEFLUOR fluorescent reagent system (Stem Cell Technologies, Vancouver, Canada).

Mouse subcutaneous xenograft model

The Animal Research Committee of Nagoya University approved all animal experiments (approval number 31370). Cells (106/injection) were resuspended in 100 μL of a 1:1 mixture of PBS and Matrigel (BD Biosciences) and injected subcutaneously (s.c.) into both flanks of 9-week-old male BALB/c nu/nu mice (n = 3/group; Japan SLC, Inc. Hamamatsu, Japan).

Generation of rabbit anti-NPTXR pAbs

Two anti-NPTXR pAbs (pAb-1 and pAb-2; antiserum) were generated by immunizing rabbits with synthetic peptides containing NPTXR epitopes predicted to be immunogenic by in silico analysis. Peptides were synthesized by solid-phase peptide synthesis with the fluorenyl-methoxy-carbonyl method (CESGLPRGLQGAGPRRDT for pAb-1 and KERVALSHSSRRQRQEVE for pAb-2).

Immunofluorescence microscopy and immunohistochemistry (IHC)

Cells were seeded on coverslips and fixed, and then incubated with anti-NPTXR pAb-1 overnight. The cells were washed and then incubated with Alexa Fluor 488-conjugated anti-rabbit IgG (H + L) secondary Ab (Cell Signaling Technology, Danvers, MA, USA).

NPTXR protein expression was analyzed in 80 formalin-fixed and paraffin-embedded sections of well-preserved tissues from patients with GC using anti-NPTXR pAb-1 diluted 1:100 in Ab diluent (Dako, Glostrup, Denmark).

Generation of mAbs against NPTXR

Three 6-week-old female BALB/c mice were immunized s.c. twice at 3-week intervals with 40 μg of peptide CESGLPRGLQGAGPRRDT and then once more 3 weeks later with 40 μg peptide delivered by intraperitoneal (i.p.) injection. Splenocytes were prepared, fused with P3U1 myeloma cells. The best three clones based on Ab titer and inhibitory activity were selected for further evaluation and designated anti-NPTXR mAb-1, − 2, and − 3. NPTXR mAb-1 was further characterized by epitope mapping and Ab-dependent cell-mediated cytotoxicity (ADCC) assay using an ADCC Reporter Bioassay Kit (Promega, Madison, WI, USA).

Mouse xenograft model of GC peritoneal metastasis

MKN1 cells stably expressing luciferase (106 cells/mouse) were injected into peritoneal cavity (i.p.) of 10-week-old male BALB/c nu/nu mice (n = 4) to establish a model of GC metastasis to the peritoneum. The mice were then injected i.p. twice a week for 6 weeks with 6 μg of normal mouse IgG (control; 140–09511, FUJIFILM Wako Pure Chemical Corporation, Tokyo, Japan), or anti-NPTXR pAb-1, pAb-2, mAb-1, mAb-2, or mAb-3.

Profiling of intracellular signaling

Phosphorylation of 1006 unique sites in 409 signaling proteins using the PTMScan® Direct Multi-Pathway Kit (Cell Signaling Technology). Pull-down assay was performed to assess activation of small GTPases using an Arf6 Activation Assay Kit and Pan-Ras Activation Assay Kit (STA-407-6 and STA-400, respectively; Cell Biolabs, San Diego, CA, USA).

Generation of Nptxr−/− mice

Nptxr−/− mice were generated using the CRISPR/Cas9 system [17]. Mutations in the Nptxr allele were confirmed by direct sequencing (Eurofins Genomics Co Ltd., Tokyo, Japan). Appearance and body weight were monitored for 8 weeks, and the development of major organs (macroscopic appearance and histology) and blood tests (blood counts and biochemistry) were evaluated at 8 weeks after birth in groups of Nptxr+/+, Nptxr+/−, and Nptxr−/−mice (n = 8 each). We also assessed general motor coordination and motor ability using the rotarod test (Economex Rotarod; Columbus Instruments, Columbus, OH, USA) when the mice were 6–8 weeks of age [18]. Three tests were performed (n = 10 mice/group) to measure the time spent on the rod, and the longest time was recorded. An arbitrary time limit of 300 s was set for the experiment.

Results

Elevated expression of NPTXR in GC tissues of patients with peritoneal, hematogenous, and nodal metastasis

We analyzed the transcriptomes of GC tissue specimens from four patients each with no metastasis for > 5 years or with liver, peritoneal, or distant nodal metastasis within 2 years after surgery. An extraction diagram of candidate genes identified by global expression analysis was shown in Additional file 3 (Fig. S1). A total of 14 genes were expressed at significantly higher levels in the 12 patients with metastasis compared to those without (Additional file 4: Table S2). Of these, we selected NPTXR for further analysis for three reasons: (i) NPTXR encodes a single-pass transmembrane protein that may serve as a target of therapeutic antibodies, (ii) the roles of NPTXR in GC have not yet been investigated, and (iii) the nucleotide sequence of NPTXR is available (NM_014293.4).

Expression of NPTXR and co-expression of cancer-related genes in GC cell lines

We performed qRT-PCR analysis of 14 human GC cell lines and found that NPTXR mRNA was differentially expressed compared with the control normal epithelial cell line FHs74 (Fig. 1a). Levels of microtubule associated protein 1B (MAP 1B) and matrix metallopeptidase 9 (MMP9) mRNAs correlated positively with those of NPTXR mRNA, whereas there was an inverse correlation between the levels of nudixtype motif 13 (NUDT13) and NPTXR mRNAs (Fig. 1a).

Fig. 1
figure 1

Expression of NPTXR in GC cell lines and effect of NPTXR knockdown, knockout, or overexpression on cell phenotypes. a qRT-PCR analysis of NPTXR, MAP 1B, MMP9, and NUDT13 mRNA in the indicated human GC cell lines. b CCK-8 proliferation assay of parental and NPTXR-knockdown (KD, siRNA-mediated) MKN1, N87, and NUGC3 cells. c-f CCK-8 proliferation assay c, wound healing migration assay d, Matrigel invasion assay, e and in vivo tumorigenicity f of parental and NPTXR-KD (shRNA-mediated) MKN1 cells. g qRT-PCR analysis and CCK-8 proliferation assay of control and NPTXR-overexpressing NUGC3 cells. *P < 0.05. Mean ± standard deviation

Effect of NPTXR KD and overexpression on the metastatic behavior of GC cells in vitro

To investigate the involvement of NPTXR in GC cell function, we examined the effects of modulating NPTXR levels. MKN1 (differentiated type), N87 (differentiated type), and NUGC3 (undifferentiated type) GC cells were selected for siRNA-mediated and shRNA-mediated NPTXR KD based on their relatively high expression levels. We confirmed that siNPTXR transfection specifically reduced NPTXR mRNA levels in MKN1, N87, and NUGC3 cells compared with the corresponding siControl-transfected cells (Additional file 5: Fig. S2a). In addition, NPTXR KD inhibited the proliferation of all three cells lines compared with the siControl and untransfected cells (Fig. 1b). To verify these results, we generated GC cell lines stably expressing NPTXR shRNA or a control shRNA. After confirmation of downregulation of NPTXR mRNA in shNPTXR-transfected cells compared with the control cells (Additional file 5: Fig. S2b), we examined cell proliferation (Fig. 1c), migration (Fig. 1d), and invasion (Fig. 1e) in vitro, and we found that NPTXR KD significantly attenuated all three functions. To confirm that these results translated to the growth of GC cells in vivo, we injected shControl- or shNPTXR-expressing MKN1 cells s.c. into BALB/c nu/nu mice and monitored the tumor growth. Indeed, the growth of NPTXR KD tumors was reduced compared with that of the control tumors (Fig. 1f).

To determine whether NPTXR overexpression had the opposite effects on GC cell behavior, we transfected NUGC4 cells, which expressed low levels of endogenous NPTXR, with a control (empty) or NPTXR expression plasmid (Additional file 5: Fig. S2c) and examined cell proliferation. Compared with cells expressing the empty plasmid, NPTXR-overexpressing NUGC4 cells exhibited enhanced proliferation (Fig. 1g). Thus, NPTXR plays a pivotal role in controlling the proliferation and other metastatic behaviors of GC cells.

CRISPR/Cas9-mediated NPTXR deletion in GC cells

We selected MKN1 cells for NPTXR KO because it expressed high NPTXR expression levels and was originally derived from a liver metastasis lesion from a GC patient. After CRISPR/Cas9 editing, two clones with stable NPTXR KO were generated (KO-1 and KO-2), and confirmed by direct sequence analysis to harbor the expected deletion (Fig. 2a). NPTXR protein was also undetectable in both clones by western blot analysis (Fig. 2b).

Fig. 2
figure 2

Effects of NPTXR knockout on survival phenotypes of GC cell lines. a Direct sequence analysis confirming successful editing of NPTXR exon 1. Insertion of a T around the target site of the gRNA was observed. Red arrow indicates the frame-shift site. b Western blot analysis confirming NPTXR knockout (KO) in MKN1 cells. c-g CCK-8 proliferation assay c, annexin V flow cytometric apoptosis assay d, flow cytometric mitochondrial membrane potential assay e, colorimetric activated caspase-3 and -9 assay f, and flow cytometric cell cycle analysis assay g of parental and NPTXR KO MKN1 cells. *P < 0.05. Mean ± standard deviation

Effect of stable NPTXR KO on the survival phenotype of GC cell lines

To further investigate the oncological functions of NPTXR, we examined the proliferation, cell cycle progression, and apoptosis of KO-1, KO-2, and parental MKN1 cells. As expected from the results with NPTXR KD cells, the proliferation of KO-1 and KO-2 cells was attenuated compared with the control cells (Fig. 2c). In addition, apoptosis was significantly more prevalent among the KO cell lines than the parental line, as determined by annexin V staining (Fig. 2d). To determine whether apoptosis in NPTXR KO cells occurred via the mitochondrial pathway, we also evaluated differences in mitochondrial membrane potential using a fluorescence assay. Notably, a higher proportion of KO-1 and KO-2 cells than control cells exhibited disruption of the mitochondrial membrane potential (Fig. 2e). Moreover, total caspase activity was increased in KO-1 and KO-2 cells compared with control MKN1 cells (Fig. 2f), with preferential increases detected in caspase-3 and -9 activities (Fig. 2f). To evaluate the effects of NPTXR KO on cell cycle progression, we examined the proportion of cells in each phase of the cycle. NPTXR KO resulted in an accumulation of cells in G2/M phase compared with control MKN1 cells, as measured using both flow cytometric and colorimetric cell cycle assays (Fig. 2g).

Effects of stable NPTXR KO on the metastatic potential phenotype of GC cells

Next, we evaluated several characteristic oncological behaviors in NPTXR KO and control MKN1 cells. Both migration, as measured using a wound-healing assay (Fig. 3a), and invasion, as measured using Matrigel assays (Fig. 3b) were attenuated by NPTXR KO in both cell lines compared with control MKN1 cells. In addition, the KO cells exhibited reduced adhesion to five ECM proteins compared with control MKN1 cells (Fig. 3c). To determine whether NPTXR KO affects the presence of GC subpopulations with cancer stem cell-like properties, we examined ALDH levels and found that ALDH was reduced in the KO-1 and KO-2 cells compared with the control MKN1 cells (Fig. 3d). Consistent with the essential role of NPTXR in GC cell biology detected here, we also found that NPTXR KO reduced the sensitivity of MKN1 cells to 5-FU, as measured by cell proliferation (Fig. 3e). Finally, we confirmed the influence of stable NPTXR KO on tumor growth in vivo using the BALB/c nu/nu mouse xenograft model, in which control or NPTXR-KO-1 MKN1 cells were injected s.c. While tumors formed by the control cells grew progressively over eight weeks, NPTXR KO greatly reduced cell growth (Fig. 3f), as indicated by the significantly smaller tumor volumes formed by NPTXR-KO-1 cells compared with the control MKN1 cells (Fig. 3f).

Fig. 3
figure 3

Effects of NPTXR knockout on the carcinogenic and drug resistance phenotypes of GC cell lines. a-c Wound-healing migration assay a, Matrigel invasion assay b, and extracellular matrix protein adhesion assay c of parental, NPTXR-KO-1, and NPTXR-KO-2 MKN1 cells. d Flow cytometric assay of ALDH-positive control (left panels) and NPTXR-KO (test, right panels) MKN1 cells. e CCK-8 proliferation assay of 5-fluorouracil (FU) sensitivity of parental and NPTXR-KO MKN1 cells after 3 days incubation. f Growth of parental and NPTXR-KO MKN1 xenografts in BALB/c nu/nu mice. *P < 0.05. Mean ± standard deviation

Production of pAbs against NPTXR and efficacy in vivo

To assess the potential anti-cancer therapeutic value of Ab-mediated blockade of NPTXR in GC and to determine the optimal antigenic site, we next generated and tested pAbs. Rabbits were immunized with two NPTXR peptides predicted to be immunogenic (Fig. 4a). Antisera were collected and two preparations of pAbs were purified and designated pAb-1 and pAb-2. The pAbs were then used to examine the subcellular localization of NPTXR by immunofluorescence microscopy. In both MKN1 and N87 cells, NPTXR was detected at the plasma membrane, as expected from its known structure (Fig. 4b). We also determined whether pAb-mediated blockade of NPTXR could attenuate GC cell proliferation, and found that both pAb-1 and pAb-2 significantly inhibited the proliferation of MKN1 cells compared with IgG control treatment (Additional file 6: Fig. S3a).

Fig. 4
figure 4

Characterization of anti-NPTXR pAbs and mAbs. a Bioinformatics analysis of predicted immunogenic epitopes in NPTXR. b Immunofluorescence microscopy of MKN1 and N87 cells labeled with NPTXR-pAb-1 and Alexa Fluor 488 (green). Nuclei were stained with DAPI (blue). c IVIS analysis of representative BALB/c nu/nu mice injected with luciferase-expressing parental or NPTXR-KO MKN1 cells. Mice were injected with d-luciferin for 15 min and imaged 3 weeks after cell injection. d ELISA assay of sera from mice 3 weeks after immunization and boosting with NPTXR peptide. e CCK-8 proliferation assay of MKN1 cells incubated with NPTXR mAb-1, − 2 and − 3. f Therapeutic effects of intraperitoneal administration of anti-NPTXR monoclonal antibodies. g CCK-8 proliferation assay of MKN1 cells treated with 5-fluorouracil (5-FU) and NPTXR-mAb-1. *P < 0.05. Mean ± standard deviation

We next evaluated the potential therapeutic effects of the NPTXR pAbs in vivo. Whole-body imaging of the mice revealed an intense luciferin fluorescence signal in mice injected with control IgG but a much reduced signal in animals in the pAb-1 and pAb-2 treatment groups three weeks after cell injection (Fig. 4c). The macroscopic appearance of peritoneal metastases 6 weeks after cell injection is shown in Additional file 6 (Fig. S3b). Few peritoneal nodules were observed in the mice treated with anti-NPTXR pAbs, whereas many large tumor nodules were present in the omentum and mesenteric tissue in mice treated with control IgG (Additional file 6: Fig. S3b). Consistent with this, the total volume of peritoneal nodules was significantly smaller in mice treated with pAbs compared with control IgG (Additional file 6: Fig. S3b). Importantly, over the 6-week experiment, anti-NPTXR pAbs had no significant effect on gross clinical signs, food intake, or body weight. These results that Ab-mediated blockade of NPTXR may be a feasible approach to the treatment of GC.

Production and characterization of mAbs against NPTXR

Having established that anti-NPTXR pAbs suppress tumor growth in vitro and in vivo, we next generated mouse mAbs against the same NPTXR sequence (161–178 CESGLPRGLQGAGPRRDT) as that used to raise pAb-1. After fusion of splenocytes and screening and cloning of hybridomas, we selected three mAb-producing clones for expansion and purification of mAbs (designated mAb-1, − 2, and − 3; Fig. 4d and Fig. 4e). The therapeutic potential of the three mAbs was assessed using the mouse xenograft model. BALB/c nu/nu mice were injected i.p. with parental MKN1 cells and then injected i.p. with 6 μg of control IgG or mAb-1, − 2, or − 3 twice weekly for 4 weeks. The macroscopic appearance of peritoneal metastases 4 weeks after cell injection is shown in Fig. 4f. Tumor nodules were observed in the omentum and mesenteric tissue of all mice treated with control IgG, whereas none were found in the mAb-treated mice. As expected from this observation, the total volume of peritoneal nodules was smaller for the groups treated with mAb-1, mAb-2, and mAb-3 groups compared with the control IgG group (Additional file 6: Fig. S3c). No overt signs of mAb toxicity were observed in any of the mice over the 4-week treatment period.

Based on these findings, we selected NPTXR-mAb-1 for further characterization. mAb-1 inhibited the proliferation of a range of GC cell lines of differential histologic types and with different NPTXR expression levels (Additional file 7: Fig. S4a), including N87 (differentiated) and MKN45 (undifferentiated) cells. To determine whether mAb-1 treatment affects drug resistance, MKN1 cells were incubated with mAb-1 in combination with various concentrations of 5-FU or cisplatin. Notably, mAb-1 synergistically enhanced the antiproliferative effect of both 5-FU (Fig. 4g) and cisplatin (Additional file 7: Fig. S4b), consistent with the finding that NPTXR KO sensitized MKN1 cells to 5-FU.

To determine the precise epitope in NPTXR recognized by mAb-1, we performed epitope mapping using a competition ELISA that tested 26 peptides (15-mers) encompassing amino acids 151–190 of NPTXR (IRELTGKLGRCESGLPRGLQGAGPRRDTMADGPWDSPALI). This analysis identified GLPRGLQGAGPRRDT as the epitope recognized by mAb-1 (Fig. 5a). Next, we probed the potential anti-cancer mechanism of action of anti-NPTXR mAb-1. In addition to steric or functional blockade of target proteins, therapeutic Abs can target virus-infected or other diseased cells for destruction by immune cells, such as natural killer cells, through the process of ADCC. Using a cell-based ADCC reporter assay, we found that NPTXR-mAb-1 could not mediate ADCC (Fig. 5b), suggesting that its in vivo ability to reduce tumor growth occurred via a non-cytolytic mechanism.

Fig. 5
figure 5

Signal transduction pathways associated with NPTXR. a Epitope mapping of the amino acid sequence targeted by NPTXR-mAb-1 by ELISA. b Antibody-dependent cell-mediated cytotoxicity assay of MKN1 cells in the presence of CD20-mAb or NPTXR-mAb-1. c Overview of the antibody array results. Data are expressed as the fold-change induced by treatment of MKN1 cells with NPTXR-mAb-1 or by transfection with NPTXR-targeting siRNA. d Analysis of phosphorylated AKT levels in MKN1 or NPTXR-KO cells. e Hypothetical role of NPTXR in signaling pathways and cell phenotypes

Association of NPTXR with intracellular signaling pathways

NPTXR-KO-1 and NPTXR-KO-2 cells expressed lower levels of MAP 1B and MMP9 and higher levels of NUDT13 compared with those of MKN1 cells (Additional file 8: Fig. S5a), supporting the reproducibility of the PCR array analysis. We identified signals altered both in cells treated by siNPTXR and NPTXR-mAb using the antibody array analysis, and the results were summarized in Fig. 5c. Loss of NPTXR function suppressed the phosphorylation of PI3K and AKT, enhanced the phosphorylation of GSK3B, and suppressed signaling via the FAK–JNK, YAP, and β-catenin pathways. In contrast, NPTXR inhibition or silencing had no effect on the phosphorylation of JAK or BCL-2, or on MEK–p44 MAPK–ERK1/2 signaling. With respect to signaling events involved in cell cycle regulation, phosphorylation of BCCIP, CLSPN, and CCND was decreased by inhibition/silencing of NPTXR. The reproducibility of the findings from the antibody array experiments was assessed by flow cytometric analysis of MAPK and PI3K signaling. NPTXR KO had no effect on the phosphorylation of ERK in either of the KO cells (Additional file 8: Fig. S5b), but phosphorylation of AKT (a surrogate marker of activation of the PI3K pathway) was reduced compared with control MKN1 cells (Fig. 5d). Moreover, we found that the small GTPases RAS-GTP and Arf6-GTP were inactivated by NPTXR KO, suggesting that they may be potential scaffolding proteins of NPTXR (Additional file 8: Fig. S5c). Collectively, these data suggest that NPTXR plays numerous roles in intracellular dynamics and signaling pathways, as summarized in Fig. 5e.

Generation and characterization of Nptxr−/− mice

To clarify the pathophysiological functions of NPTXR, we generated Nptxr+/+, Nptxr +/−, and Nptxr −/− mice (Fig. 6a). Direct sequencing analysis of the mice confirmed the deletion of 64 bases by genome editing at the Nptxr locus (Fig. 6b). KO of one or both Nptxr alleles (Nptxr+/− and Nptxr−/− mice) was not embryonic lethal and had no effect on the appearance (Fig. 6c) or body weight (Additional file 9: Fig. S6a) of the mice, and did not result in any abnormalities in the development of the liver, lung, and brain (Fig. 6c), metabolic parameters (Additional file 9: Fig. S6b), or hematological parameters (Additional file 9: Fig. S6c). Moreover, neither the Nptxr+/− nor the Nptxr−/− mice exhibited dysfunctional motor coordination or motor learning, as measured by the rotarod test (Fig. 6d).

Fig. 6
figure 6

Characterization of Nptxr−/− mice. a Genotyping of Nptxr+/+, Nptxr+/−, and Nptxr−/− mice. b Direct sequencing of the 64-nucleotide deletion at the NPTXR locus of Nptxr−/− mice. c Appearance of major organs from Nptxr+/+, Nptxr+/−, and Nptxr −/− mice. d Rotarod test of motor coordination and learning by Nptxr+/+, Nptxr+/−, and Nptxr −/− mice. e and f Renal e and liver f function tests of Nptxr+/+, Nptxr+/−, and Nptxr −/− mice

Clinical significance of NPTXR expression in GC tissues

NPTXR mRNA levels increased incrementally in specimens from patients with stage I, II/III, and IV GC compared with normal gastric mucosal tissue (Fig. 7a). Patients with stage II/III GC who developed disease recurrence had significantly higher NPTXR mRNA levels compared with patients without recurrence. In ROC curve analysis of the ability of NPTXR levels to predict cancer-related mortality, the AUC was 0.651 and the optimal cut-off value was 0.0086 (Additional file 10: Fig. S7a). Using this cut-off value, patients were dichotomized into high- or low-NPTXR expression groups. We found that high NPTXR expression was significantly associated with male sex, macroscopic Borrmann type 4 or 5, pathological T4, and undifferentiated tumor type (Additional file 11: Table S3). We next focused on 230 patients with stage I–III GC and analyzed survival after curative resection. After dichotomization of patients using the ROC cut-off value, the high-NPTXR group was found to have shorter overall and disease-free survival times than the low-NPTXR group (Fig. 7b). Similar results were obtained using an external validation dataset of 1065 patients (Fig. 7b). Multivariable analysis identified high NPTXR expression as an independent prognostic factor for GC patients (Additional file 12: Table S4). The high-NPTXR group also had a higher prevalence of peritoneal, lymph node, and hematogenous recurrence compared with the low-NPTXR group (16% vs 6, 13% vs 6, and 11% vs 8%, respectively) (Additional file 10: Fig. S7b). We conducted a subgroup analysis according to postoperative adjuvant chemotherapy (5-FU-based) to explore further the clinical significance of NPTXR expression in GC. Influence of the NPTXR expression on survival depended on whether the patients received postoperative adjuvant chemotherapy or not. The survival difference between the low and high NPTXR groups was greater in the subgroup of patients who received adjuvant chemotherapy after curative gastrectomy compared to that of patients who underwent surgery alone (Additional file 10: Fig. S7c). These results suggest that NPTXR expression reflects resistance to adjuvant chemotherapy.

Fig. 7
figure 7

Clinical significance of NPTXR expression in gastric tissues from patients with GC. a qRT-PCR analysis of NPTXR mRNA levels in 80 pairs of GC and matched adjacent normal gastric tissues according to disease stage and the presence or absence of disease recurrence (Rec). b Kaplan–Meier curves of overall and disease-free survival of patients in the institutional and validation cohorts with stage I–III GC according to NPTXR expression. c Representative images of IHC staining of NPTXR protein expression in gastric tissue sections. Left panel, section with undetectable NPTXR expression; right panels, sections with positive NPTXR expression

IHC analysis of NPTXR expression in gastric tissues

Finally, we explored the utility of the anti-NPTXR pAb-1 as a potential diagnostic tool by performing IHC staining of GC tissues. Images of representative sections with negative or positive NPTXR immunoreactivity are shown in Fig. 7c. Among the 80 patients assessed, 32 were positive for NPTXR in the primary tumor, and the incidence of disease recurrence was higher in patients with NPTXR-positive tumors compared with those with NPTXR-negative tumors (31 and 8%, respectively, P = 0.009; Fig. 7c).

Discussion

Metastasis is a major cause of death in patients with GC [1, 19]. A better understanding of the molecular mechanisms underlying metastasis is therefore essential for developing novel and innovative therapeutic strategies and risk assessment biomarkers [20, 21]. As a first step towards this, we conducted transcriptome analysis of GC tissues from patients with and without metastasis and identified NPTXR as one of 14 genes with significant overexpression in GC tissues metastasized to diverse organs. We generated GC cell lines with NPTXR KD, KO, and overexpression, developed anti-NPTXR pAbs and mAbs, investigated the involvement of NPTXR in GC cell functions in vitro and in vivo, and generated a new strain of Nptxr−/− mice. Our results indicate that NPTXR regulates several cell behaviors associated with the malignant phenotype and metastatic potential of GC cells via multiple intracellular signaling pathways, including the PI3K–AKT–mTOR and FAK–JNK pathways. We also showed that anti-NPTXR pAb and mAbs had therapeutic effects in a mouse model of peritoneal metastasis. It is a significant advance in further understanding of physiological roles of NPTXR that we first found no adverse effects on reproduction, development, or metabolic or motor functions by genetic deletion of NPTXR in mice. Collectively, these results not only suggest that NPTXR may be an excellent therapeutic target for metastatic GC but also indicate that NPTXR-targeting mAbs can effectively suppress GC growth in vivo in the absence of ADCC.

NPTXR is a receptor for synapse-associated neuronal NPTX, and it is expressed at higher levels in the brain compared with other organs [11, 22]. Among the NPTX family proteins, NPTXR is unique in possessing a transmembrane domain and in its ability to anchor NPTX complexes to plasma membranes [23, 24]. NPTXR is also cleaved by the extracellular protease tumor necrosis factor-α converting enzyme to release a soluble form of NPTXR [10, 25]. Members of the NPTX family function during synapse formation and remodeling by facilitating the uptake of synaptic materials [24, 25]. NPTXR and NPTX2 are overexpressed in human Schwannian stroma-poor neuroblastoma [12, 22, 26], and NPTX2 expression serves as a marker of poor prognosis of neuroblastoma patients [12]. Bartolini et al. investigated expression and functions of NPTX1, NPTX2 and NPTXR in glioblastoma [12]. They found that blockade of ligand-receptor connection between NPTX2 and NPTXR reduces tumor burden in orthotopic mouse models of human neuroblastoma [12]. However, the oncological roles of NPTXR in gastroenterological malignancies are unknown.

We focused on determining the involvement of NPTXR in the malignant phenotype of GC cells by gene-specific ablation or overexpression and Ab-mediated inhibition of function. NPTXR KD, KO, or Ab-mediated blockade significantly inhibited the proliferation of multiple GC cell lines, possibly via facilitation of apoptosis and/or induction of G2/M arrest [27]. Apoptosis is predominantly mediated via two pathways; the intrinsic mitochondria pathway, which involves activation of caspases and the disruption of mitochondrial membrane potential, and the extrinsic death receptor pathway, which requires engagement of cell surface death receptors [28, 29]. Notably, NPTXR KO increased caspase activity, particularly caspase-9, and induced a striking decrease in mitochondrial membrane potential. Caspase-9 is a cysteine-aspartic protease associated with cytokine signaling and apoptosis [30, 31]. Apoptotic signals cause the release of cytochrome c from mitochondria and activation of apoptosis protease-activating factor 1, which then cleaves procaspase-9 into the active homodimer [30, 31]. Our results thus suggest that NPTXR regulates apoptosis through mitochondrial-dependent activation of caspase-9.

The involvement of NPTXR in oncogenesis is also supported by our findings that NPTXR KO attenuated many biological properties (migration, invasion, and stemness) required for GC metastasis. High ALDH activity is a hallmark of cancer stem cells [32], which are able to evade the effects of chemotherapy and radiotherapy through their ability to self-renew and differentiate into tumor cells after treatment is discontinued, leading to recurrence and/or metastasis [33]. In the present study, NPTXR KO decreased the frequency of ALDH-positive GC cells, indicating that NPTXR influences the stemness of GC cells. We speculate that the decreased stemness of NPTXR-KO cells may be associated with their increased sensitivity to 5-FU. NPTXR KO also resulted in a reduction of tumor growth in the mouse xenograft model of s.c. GC.

Consistent with the paucity of information on the roles of NPTXR in oncogenesis, little is known about the interactions between NPTXR and cancer-related pathways. We explored NPTXR-associated gene expression using two approaches. First, we performed PCR array analysis, which showed that NPTXR expression may influence or be influenced by MAP 1B, MMP9, and NUDT13, which contribute to the EMT, a crucial process in carcinogenesis. MAP 1B is upregulated in cells during an EMT-like process that operates during wound healing [34, 35]. MMP9 is a matrix metalloproteinase involved in the degradation of the ECM in physiological processes such as tissue remodeling and embryonic development, as well as in pathological processes such as the progression of arthritis and cancer metastasis [36, 37]. NUDT13 is a mitochondrial enzyme reported to be downregulated during the EMT [38]. As a second method to explore cancer-related pathways, we performed antibody array analysis to identify alterations in the phosphorylation of intracellular signaling proteins GC cells with loss of NPTXR expression or function. NPTXR KO or mAb treatment resulted in inactivation of the PI3K–AKT–GSK3B, FAK–JNK, and YAP signaling pathways, but not of MAPK and JAK–STAT signaling. PI3K–AKT–mTOR is a key signaling pathway involved in numerous cellular processes [39]; YAP1 modulates cancer stem cell properties, such as sphere formation, self-renewal, invasiveness, and drug resistance, via the Hippo and Wnt/β-catenin pathways [40]; and FAK regulates cell growth, survival, migration, and invasion through its dual functions as a kinase and a scaffold protein [41]. FAK autophosphorylation leads to the recruitment of Src and the phosphorylation of binding sites for downstream effector pathways, including JNK and the transcriptional regulation of pro-invasive genes like MMP9 [41, 42]. Previous studies indicate that the PI3K–AKT–GSK3B, FAK–JNK, and YAP signaling pathways interact with each other during cancer development and progression. Kinase function of FAK has been shown to activate the PI3K-AKT pathway [43]. FAK binds p85 subunit of PI3K, and phospholipid production stimulated by FAK association and activation of PI3K can activate AKT kinase, leading to inhibition of apoptosis by regulating various cell death machinery proteins [43, 44]. Moreover, it has been reported that concomitant activation of YAP1 and PI3K promotes development of liver tumors through activation of AKT/mTOR signaling [40]. Our findings suggest that NPTXR modulates the network of AKT, FAK and YAP pathways and contributes to GC progression.

We investigated the potential therapeutic effects of anti-NPTXR Abs using a mouse xenograft model of peritoneal metastasis. Both pAbs and mAbs significantly inhibited tumor formation in this model and the anti-NPTXR mAbs also enhanced the cytotoxicity of 5-FU and cisplatin in vitro, supporting the possibility that NPTXR may be a promising therapeutic target for controlling GC progression and/or for overcoming chemotherapy resistance. We also showed that the anti-cancer effects of the mAbs in vivo resulted from NPTXR antagonism rather than as mediators of ADCC [45]. Finally, we identified the precise epitope recognized by our NPTXR mAbs, which is a critical step in developing and engineering therapeutic mAbs. Further work, including humanization of the mAbs and additional preclinical efficacy and toxicity testing, will be required before these promising findings can be translated to the clinic. Along these lines, another important finding in the present study is that Nptxr−/− mice exhibit no abnormalities in reproduction, development, metabolism, or motor functions, and that treatment of mice for up to 6 weeks with anti-NPTXR pAbs and mAbs elicited no overt clinical signs or adverse effects. These are important observations for understanding the potential effects of clinical NPTXR targeting on physiological homeostasis.

Our findings have clinical relevance, as demonstrated by the association between NPTXR expression in patient specimens and outcomes. We found that NPTXR mRNA level in clinical samples is an independent prognostic factor in GC, and these findings were confirmed using an independent external validation dataset. Our IHC analysis also indicated that NPTXR protein expression may serve as a novel biomarker of disease recurrence, which can easily be determined through analysis of surgical specimens or endoscopic biopsy samples. Further, like HER2 amplification NPTXR expression may be utilized, for example, as a companion diagnostic to identify patients potentially sensitive to anti-NPTXR therapy.

Several limitations of our study should be acknowledged. It remains unclear whether NPTX1 and NPTX2 act as ligands of NPTXR in GC cells or not. We evaluated the effects of anti-NPTXR pAbs and mAbs only in a mouse model, and the frequency, administration route, optimal dose, and optimal duration of treatment and survival benefits were not determined. Patient-derived xenograft models may be helpful for understanding the oncological involvement of NPTXR. The development of assays to detect NPTXR expression levels in serum will likely facilitate the translation of our findings to the clinic.

Conclusions

We identified NPTXR as a cell surface receptor that modulates multiple oncological processes in GC cells, including behaviors associated with metastasis. NPTXR-targeting Abs may have utility in GC, not only as innovative therapeutic agents but also as companion diagnostic tools.

Availability of data and materials

All the data obtained and/or analyzed during the current study were available from the corresponding authors on reasonable request.

Abbreviations

ALDH:

Aldehyde dehydrogenase

AUC:

Area under the curve

IHC:

Immunohistochemistry

NPTXR:

Neuronal pentraxin receptor

qRT-PCR:

Quantitative reversetranscription polymerase chain reaction

ROC:

Receiver operating characteristic

siRNA:

Small interfering RNA

References

  1. Van Cutsem E, Sagaert X, Topal B, Haustermans K, Prenen H. Gastric cancer. Lancet. 2016;388:2654–64.

    Article  Google Scholar 

  2. Thrift AP, El-Serag HB. Burden of gastric Cancer. Clin Gastroenterol Hepatol. 2020;18:534–42.

    Article  Google Scholar 

  3. Wilke H, Muro K, Van Cutsem E, Oh SC, Bodoky G, Shimada Y, Hironaka S, Sugimoto N, Lipatov O, Kim TY, et al. Ramucirumab plus paclitaxel versus placebo plus paclitaxel in patients with previously treated advanced gastric or gastro-oesophageal junction adenocarcinoma (RAINBOW): a double-blind, randomised phase 3 trial. Lancet Oncol. 2014;15:1224–35.

    Article  CAS  Google Scholar 

  4. Muro K, Chung HC, Shankaran V, Geva R, Catenacci D, Gupta S, Eder JP, Golan T, Le DT, Burtness B, et al. Pembrolizumab for patients with PD-L1-positive advanced gastric cancer (KEYNOTE-012): a multicentre, open-label, phase 1b trial. Lancet Oncol. 2016;17:717–26.

    Article  CAS  Google Scholar 

  5. Shitara K, Ozguroglu M, Bang YJ, Di Bartolomeo M, Mandala M, Ryu MH, Fornaro L, Olesinski T, Caglevic C, Chung HC, et al. Pembrolizumab versus paclitaxel for previously treated, advanced gastric or gastro-oesophageal junction cancer (KEYNOTE-061): a randomised, open-label, controlled, phase 3 trial. Lancet. 2018;392:123–33.

    Article  CAS  Google Scholar 

  6. Fuchs CS, Tomasek J, Yong CJ, Dumitru F, Passalacqua R, Goswami C, Safran H, dos Santos LV, Aprile G, Ferry DR, et al. Ramucirumab monotherapy for previously treated advanced gastric or gastro-oesophageal junction adenocarcinoma (REGARD): an international, randomised, multicentre, placebo-controlled, phase 3 trial. Lancet. 2014;383:31–9.

    Article  CAS  Google Scholar 

  7. Kanda M, Suh YS, Park DJ, Tanaka C, Ahn SH, Kong SH, Lee HJ, Kobayashi D, Fujiwara M, Shimada H, et al. Serum levels of ANOS1 serve as a diagnostic biomarker of gastric cancer: a prospective multicenter observational study. Gastric Cancer. 2020;23:203–11.

    Article  Google Scholar 

  8. Lei Z, Tan IB, Das K, Deng N, Zouridis H, Pattison S, Chua C, Feng Z, Guan YK, Ooi CH, et al. Identification of molecular subtypes of gastric cancer with different responses to PI3-kinase inhibitors and 5-fluorouracil. Gastroenterology. 2013;145:554–65.

    Article  CAS  Google Scholar 

  9. Tan IB, Ivanova T, Lim KH, Ong CW, Deng N, Lee J, Tan SH, Wu J, Lee MH, Ooi CH, et al: Intrinsic subtypes of gastric cancer, based on gene expression pattern, predict survival and respond differently to chemotherapy. Gastroenterology 2011, 141:476–485, 85 e1–11.

  10. Lee SJ, Wei M, Zhang C, Maxeiner S, Pak C, Calado Botelho S, Trotter J, Sterky FH, Südhof TC. Presynaptic Neuronal Pentraxin Receptor Organizes Excitatory and Inhibitory Synapses. J Neurosci. 2017;37:1062–80.

  11. Dodds DC, Omeis IA, Cushman SJ, Helms JA, Perin MS. Neuronal pentraxin receptor, a novel putative integral membrane pentraxin that interacts with neuronal pentraxin 1 and 2 and taipoxin-associated calcium-binding protein 49. J Biol Chem. 1997;272:21488–94.

    Article  CAS  Google Scholar 

  12. Bartolini A, Di Paolo D, Noghero A, Murgia D, Sementa AR, Cilli M, Pasqualini R, Arap W, Bussolino F, Ponzoni M, et al. The neuronal Pentraxin-2 pathway is an unrecognized target in human neuroblastoma, which also offers prognostic value in patients. Cancer Res. 2015;75:4265–71.

    Article  CAS  Google Scholar 

  13. Szasz AM, Lanczky A, Nagy A, Forster S, Hark K, Green JE, Boussioutas A, Busuttil R, Szabo A, Gyorffy B. Cross-validation of survival associated biomarkers in gastric cancer using transcriptomic data of 1,065 patients. Oncotarget. 2016;7:49322–33.

    Article  Google Scholar 

  14. Kanda M, Shimizu D, Tanaka H, Tanaka C, Kobayashi D, Hayashi M, Iwata N, Niwa Y, Yamada S, Fujii T, et al. Significance of SYT8 for the detection, prediction, and treatment of peritoneal metastasis from gastric Cancer. Ann Surg. 2018;267:495–503.

    Article  Google Scholar 

  15. Miwa T, Kanda M, Umeda S, Tanaka H, Shimizu D, Tanaka C, Kobayashi D, Hayashi M, Yamada S, Nakayama G, et al. Establishment of peritoneal and hepatic metastasis mouse Xenograft models using gastric Cancer cell lines. Vivo. 2019;33:1785–92.

    Article  CAS  Google Scholar 

  16. Kanda M, Tanaka H, Shimizu D, Miwa T, Umeda S, Tanaka C, Kobayashi D, Hattori N, Suenaga M, Hayashi M, et al. SYT7 acts as a driver of hepatic metastasis formation of gastric cancer cells. Oncogene. 2018;37:5355–66.

    Article  CAS  Google Scholar 

  17. Wang H, Yang H, Shivalila CS, Dawlaty MM, Cheng AW, Zhang F, Jaenisch R. One-step generation of mice carrying mutations in multiple genes by CRISPR/Cas-mediated genome engineering. Cell. 2013;153:910–8.

    Article  CAS  Google Scholar 

  18. Katsuno M, Adachi H, Kume A, Li M, Nakagomi Y, Niwa H, Sang C, Kobayashi Y, Doyu M, Sobue G. Testosterone reduction prevents phenotypic expression in a transgenic mouse model of spinal and bulbar muscular atrophy. Neuron. 2002;35:843–54.

    Article  CAS  Google Scholar 

  19. Wang SM, Tie J, Wang WL, Hu SJ, Yin JP, Yi XF, Tian ZH, Zhang XY, Li MB, Li ZS, et al. POU2F2-oriented network promotes human gastric cancer metastasis. Gut. 2016;65:1427–38.

    Article  CAS  Google Scholar 

  20. Razzak M. Genetics: new molecular classification of gastric adenocarcinoma proposed by the Cancer genome atlas. Nat Rev Clin Oncol. 2014;11:499.

    Article  Google Scholar 

  21. Liu X, Zhang X, Zhang Z, Chang J, Wang Z, Wu Z, Wang C, Sun Z, Ge X, Geng R, et al. Plasma microRNA-based signatures to predict 3-year postoperative recurrence risk for stage II and III gastric cancer. Int J Cancer. 2017;141:2093–102.

    Article  CAS  Google Scholar 

  22. Yin GN, Lee HW, Cho JY, Suk K. Neuronal pentraxin receptor in cerebrospinal fluid as a potential biomarker for neurodegenerative diseases. Brain Res. 2009;1265:158–70.

    Article  CAS  Google Scholar 

  23. Andreiuolo F, Puget S, Peyre M, Dantas-Barbosa C, Boddaert N, Philippe C, Mauguen A, Grill J, Varlet P. Neuronal differentiation distinguishes supratentorial and infratentorial childhood ependymomas. Neuro-Oncology. 2010;12:1126–34.

    Article  CAS  Google Scholar 

  24. Pelkey KA, Barksdale E, Craig MT, Yuan X, Sukumaran M, Vargish GA, Mitchell RM, Wyeth MS, Petralia RS, Chittajallu R, et al. Pentraxins coordinate excitatory synapse maturation and circuit integration of parvalbumin interneurons. Neuron. 2015;85:1257–72.

    Article  CAS  Google Scholar 

  25. Kirkpatrick LL, Matzuk MM, Dodds DC, Perin MS. Biochemical interactions of the neuronal pentraxins. Neuronal pentraxin (NP) receptor binds to taipoxin and taipoxin-associated calcium-binding protein 49 via NP1 and NP2. J Biol Chem. 2000;275:17786-92.

  26. von Roemeling CA, Radisky DC, Marlow LA, Cooper SJ, Grebe SK, Anastasiadis PZ, Tun HW, Copland JA. Neuronal pentraxin 2 supports clear cell renal cell carcinoma by activating the AMPA-selective glutamate receptor-4. Cancer Res. 2014;74:4796–810.

    Article  Google Scholar 

  27. Acikgoz E, Guven U, Duzagac F, Uslu R, Kara M, Soner BC, Oktem G. Enhanced G2/M arrest, Caspase Related Apoptosis and Reduced E-Cadherin Dependent Intercellular Adhesion by Trabectedin in Prostate Cancer Stem Cells. PLoS One. 2015;10:e0141090.

    Article  Google Scholar 

  28. Liu XD, Fan RF, Zhang Y, Yang HZ, Fang ZG, Guan WB, Lin DJ, Xiao RZ, Huang RW, Huang HQ, et al. Down-regulation of telomerase activity and activation of caspase-3 are responsible for Tanshinone I-induced apoptosis in monocyte leukemia cells in vitro. Int J Mol Sci. 2010;11:2267–80.

    Article  CAS  Google Scholar 

  29. Samykutty A, Shetty AV, Dakshinamoorthy G, Kalyanasundaram R, Zheng G, Chen A, Bosland MC, Kajdacsy-Balla A, Gnanasekar M. Vitamin k2, a naturally occurring menaquinone, exerts therapeutic effects on both hormone-dependent and hormone-independent prostate cancer cells. Evid Based Complement Alternat Med. 2013;2013:287358.

    Article  Google Scholar 

  30. Cheng CH, Cheng YP, Chang IL, Chen HY, Wu CC, Hsieh CP. Dodecyl gallate induces apoptosis by upregulating the caspase-dependent apoptotic pathway and inhibiting the expression of anti-apoptotic Bcl-2 family proteins in human osteosarcoma cells. Mol Med Rep. 2016;13:1495–500.

    Article  CAS  Google Scholar 

  31. Poli G, Guasti D, Rapizzi E, Fucci R, Canu L, Bandini A, Cini N, Bani D, Mannelli M, Luconi M. Morphofunctional effects of mitotane on mitochondria in human adrenocortical cancer cells. Endocr Relat Cancer. 2013;20:537–50.

    Article  CAS  Google Scholar 

  32. Mele L, Liccardo D, Tirino V. Evaluation and isolation of Cancer stem cells using ALDH activity assay. Methods Mol Biol. 1692;2018:43–8.

    Google Scholar 

  33. Zhou Y, Xia L, Wang H, Oyang L, Su M, Liu Q, Lin J, Tan S, Tian Y, Liao Q, Cao D. Cancer stem cells in progression of colorectal cancer. Oncotarget. 2018;9:33403–15.

    Article  Google Scholar 

  34. Tessema M, Yingling CM, Picchi MA, Wu G, Liu Y, Weissfeld JL, Siegfried JM, Tesfaigzi Y, Belinsky SA. Epigenetic repression of CCDC37 and MAP 1B links chronic obstructive pulmonary disease to lung Cancer. J Thorac Oncol. 2015;10:1181–8.

    Article  CAS  Google Scholar 

  35. Yasuda T, Iizuka K, Fukuda M, Takeda J, Natsume T, Horikawa Y, Gadoth A, Kryzer TJ, Fryer J, McKeon A, et al. Microtubule-associated protein 1B: novel paraneoplastic biomarker. Sci Rep. 2017;81:266–77.

    Google Scholar 

  36. Qin Z, Wang Y, Tang J, Zhang L, Li R, Xue J, Han P, Wang W, Qin C, Xing Q, et al. High LINC01605 expression predicts poor prognosis and promotes tumor progression via up-regulation of MMP9 in bladder cancer. Biosci Rep. 2018;38.

  37. Wang X, Wang B, Xie J, Hou D, Zhang H, Huang H. Melatonin inhibits epithelialtomesenchymal transition in gastric cancer cells via attenuation of IL1beta/NFkappaB/MMP2/MMP9 signaling. Int J Mol Med. 2018;42:2221–8.

    CAS  PubMed  Google Scholar 

  38. McLennan AG. The Nudix hydrolase superfamily. Cell Mol Life Sci. 2006;63:123–43.

    Article  CAS  Google Scholar 

  39. Singh SS, Yap WN, Arfuso F, Kar S, Wang C, Cai W, Dharmarajan AM, Sethi G, Kumar AP. Targeting the PI3K/Akt signaling pathway in gastric carcinoma: a reality for personalized medicine? World J Gastroenterol. 2015;21:12261–73.

    Article  CAS  Google Scholar 

  40. Shibata M, Ham K, Hoque MO. A time for YAP1: tumorigenesis, immunosuppression and targeted therapy. Int J Cancer. 2018;143:2133–44.

    Article  CAS  Google Scholar 

  41. Murphy JM, Jeong K, Rodriguez YAR, Kim JH, Ahn EE, Lim SS. FAK and Pyk2 activity promote TNF-α and IL-1β-mediated pro-inflammatory gene expression and vascular inflammation. Sci Rep. 2019;9:7617.

    Article  Google Scholar 

  42. Zhang Y, Peng X, Zheng Q. Ropivacaine inhibits the migration of esophageal cancer cells via sodium-channel-independent but prenylation-dependent inhibition of Rac1/JNK/paxillin/FAK. Biochem Biophys Res Commun. 2018;501:1074–9.

    Article  CAS  Google Scholar 

  43. Sulzmaier FJ, Jean C, Schlaepfer DD. FAK in cancer: mechanistic findings and clinical applications. Nat Rev Cancer. 2014;14:598–610.

    Article  CAS  Google Scholar 

  44. Kurenova E, Xu LH, Yang X, Baldwin AS Jr, Craven RJ, Hanks SK, Liu ZG, Cance WG. Focal adhesion kinase suppresses apoptosis by binding to the death domain of receptor-interacting protein. Mol Cell Biol. 2004;24:4361–71.

    Article  CAS  Google Scholar 

  45. Martin TC, Ilieva KM, Visconti A, Beaumont M, Kiddle SJ, Dobson RJB, Mangino M, Lim EM, Pezer M, Steves CJ, et al. Dysregulated antibody, natural killer cell and immune mediator profiles in autoimmune thyroid diseases. Cells. 2020;9.

Download references

Acknowledgements

We thank Edanz Group (www.edanzediting.com/ac) for editing a draft of this manuscript.

Funding

This work was supported by the Japan Agency for Medical Research and Development (17lm0203005j0001, 2017; 19cm0106163h0001, 2019–2020), the Center for Advanced Medicine and Clinical Research at Nagoya University 2018, grant 2018 from the Kobayashi Foundation for Cancer Research, and the Mochida Memorial Foundation for Medical and Pharmaceutical Research.

Author information

Authors and Affiliations

Authors

Contributions

MK (M. Kanda) designed the study, acquired materials and wrote the manuscript. DS and CT performed expression analyses including qPCR assay and immunohistochemical staining of the human tissues. HT and TM performed and analyzed the in vitro experiments. SU and SN performed the in vivo experiments. YI and KS analyzed knockout mice. SY and MH critically reviewed the manuscript. YK and MK (M. Katsuno) supervised the study and revised the manuscript. All authors read and approved the final manuscript.

Corresponding author

Correspondence to Mitsuro Kanda.

Ethics declarations

Ethics approval and consent to participate

This study was approved by the institutional review board/ethics committee of the Nagoya University Hospital (2014–0043).

Consent for publication

All authors give consent for the publication of manuscript in Molecular Cancer.

Competing interests

The authors declare that there is no potential competing interest.

Additional information

Publisher’s Note

Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Supplementary information

Additional file 1.

Supplementary Materials and Methods.

Additional file 2: Table S1.

Nucleotide sequences.

Additional file 3: Figure S1.

Extraction diagram of candidate genes identified by global expression analysis. Sixteen patients were categorized into four groups (4 patients for each) according to clinical courses as follows: group 1, no recurrences for > 5 years; group 2, hepatic-confined metastasis within 2 years after surgery; group 3, peritoneal metastasis within 2 years after surgery; and group 4, nodal metastasis within 2 years after surgery. Global expression profiling was conducted to compare the expression levels of 57,749 genes between each cluster. Among them, 14 we considered 14 genes as candidates shown in Supplemental Table 2.

Additional file 4: Table S2.

List of candidate genes upregulated in gastric cancer tissues of patients with metachronous metastasis.

Additional file 5: Figure S2.

Verification of NPTXR knockdown or overexpression in GC cells. a-c qRT-PCR analysis of NPTXR mRNA expression in MKN1, N87, and/or NUGC3 cells with siRNA-mediated knockdown (a), shRNA-mediated knockdown (b), or overexpression (c) of NPTXR. *P < 0.05. Mean ± standard deviation.

Additional file 6: Figure S3.

Characterization of polyclonal anti-NPTXR Abs effects in vitro and in vivo. a CCK-8 proliferation assay of MKN1 cells incubated with pAbs in vitro. b Therapeutic effects of intraperitoneal administration of anti-NPTXR polyclonal antibodies. Macroscopic appearance of peritoneal nodules 6 weeks after injection of MKN1 cells and treatment with control IgG or NPTXR-pAbs. c Total volumes of peritoneal nodules collected from BALB/c nu/nu mice 6 weeks after injection of MKN1 cells and treatment with control IgG or NPTXR-mAb-1, − 2, or − 3. *P < 0.05. Mean ± standard deviation.

Additional file 7: Figure S4.

Effects of NPTXR-mAb-1 on gastric cancer cells. CCK-8 proliferation assay of MKN45 (a) and N87 (b) cells incubated with NPTXR-mAb-1 in dose-dependent manner.

Additional file 8: Figure S5.

a qRT-PCR analysis of NUDT13, MAP 1B, MMP9 mRNA levels in parental MKN1, NPTXR-KO-1 and -KO-2 cells. b Flow cytometric analysis of the frequency parental and NPTXR-KO MKN1 cells with phosphorylated ERK1/2. c Pull-down of small GTPases (Ras and Arf6) in parental and NPTXR-KO MKN1 cells.

Additional file 9: Figure S6.

a Body weights of Nptxr+/+, Nptxr+/−, and Nptxr−/− mice at 4 and 8 weeks after birth. b and c Metabolic (b) and hematological (c) tests in Nptxr+/+, Nptxr+/−, and Nptxr−/− mice.

Additional file 10: Figure S7.

a ROC curve analysis of the ability of NPTXR expression level in tissue specimens to predict peritoneal metastasis in GC patients. b Frequency of the site of initial recurrence in GC patients according to NPTXR expression level. c Disease-free survival rates in subgroups according to administration of adjuvant chemotherapy.

Additional file 11: Table S3.

Patients’ clinical characteristics associated with NPTXR expression.

Additional file 12: Table S4.

Prognostic factors of patients with resectable gastric cancer.

Rights and permissions

Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.

Reprints and Permissions

About this article

Verify currency and authenticity via CrossMark

Cite this article

Kanda, M., Shimizu, D., Sawaki, K. et al. Therapeutic monoclonal antibody targeting of neuronal pentraxin receptor to control metastasis in gastric cancer. Mol Cancer 19, 131 (2020). https://doi.org/10.1186/s12943-020-01251-0

Download citation

  • Received:

  • Accepted:

  • Published:

  • DOI: https://doi.org/10.1186/s12943-020-01251-0

Keywords

  • Gastric cancer
  • Neuronal pentraxin receptor
  • Antibody
  • Knockout mouse